(data stored in ACNUC7421 zone)

EMBL: CP000270.PE395

CP000270.PE395       Location/Qualifiers
FT   CDS             439594..439869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28933"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q6"
FT                   /protein_id="ABE28933.1"
FT                   /translation="MRKSLKTPFVHHVSVMFAWAALGNDGARRRFPSDIANVFCSSAAL
FT                   RITTDNYEVGVFHRSKVWRRERFPAAKRVAPSLFVRTLRDKRAQRI"
     MRKSLKTPFV HHVSVMFAWA ALGNDGARRR FPSDIANVFC SSAALRITTD NYEVGVFHRS        60
     KVWRRERFPA AKRVAPSLFV RTLRDKRAQR I                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page