(data stored in ACNUC7421 zone)

EMBL: CP000270.PE401

CP000270.PE401       Location/Qualifiers
FT   CDS             complement(444667..445944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4060"
FT                   /product="Putative D-serine deaminase (d-serine
FT                   dehydratase) protein"
FT                   /EC_number="4.3.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28939"
FT                   /db_xref="GOA:Q145Q0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="PDB:3GWQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q0"
FT                   /protein_id="ABE28939.1"
FT                   /translation="MKVTNYQGATIDPYSKGLGMVPGTSIQLTDAARLEWNLLNEDVSL
FT                   PAAVLYADRVEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLETGAWGITLATAHQ
FT                   VRAAYHGGVSRVLMANQLVGRRNMMMVAELLSDPEFEFFCLVDSVEGVEQLGEFFKSVN
FT                   KQLQVLLELGVPGGRTGVRDAAQRNAVLEAITRYPDTLKLAGVELYEGVLKEEHEVREF
FT                   LQSAVAVTRELVEQERFARAPAVLSGAGSAWYDVVAEEFVKASETGKVEVVLRPGCYLT
FT                   HDVGIYRKAQTDIFARNPVAKKMGEGLLPALQLWAYVQSIPEPDRAIIGLGKRDSAFDA
FT                   GMPEPARHYRPGNEAPRDIAASEGWEIFGLMDQHAYLRIPAGADLKVGDMIAFDISHPC
FT                   LTFDKWRQVLVVDPAYRVTEVIETFF"
     MKVTNYQGAT IDPYSKGLGM VPGTSIQLTD AARLEWNLLN EDVSLPAAVL YADRVEHNLK        60
     WMQAFVAEYG VKLAPHGKTT MAPQLFRRQL ETGAWGITLA TAHQVRAAYH GGVSRVLMAN       120
     QLVGRRNMMM VAELLSDPEF EFFCLVDSVE GVEQLGEFFK SVNKQLQVLL ELGVPGGRTG       180
     VRDAAQRNAV LEAITRYPDT LKLAGVELYE GVLKEEHEVR EFLQSAVAVT RELVEQERFA       240
     RAPAVLSGAG SAWYDVVAEE FVKASETGKV EVVLRPGCYL THDVGIYRKA QTDIFARNPV       300
     AKKMGEGLLP ALQLWAYVQS IPEPDRAIIG LGKRDSAFDA GMPEPARHYR PGNEAPRDIA       360
     ASEGWEIFGL MDQHAYLRIP AGADLKVGDM IAFDISHPCL TFDKWRQVLV VDPAYRVTEV       420
     IETFF                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page