(data stored in ACNUC7421 zone)

EMBL: CP000270.PE409

CP000270.PE409       Location/Qualifiers
FT   CDS             456919..457347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4052"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28947"
FT                   /db_xref="GOA:Q145P2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P2"
FT                   /protein_id="ABE28947.1"
FT                   /translation="MDCVFCREDGGDVLWHDDTLRVVLADEHDYPGFCRVIWNGHVAEF
FT                   SDLDGNDRDRVMKAVYAVERAIRRILQPAKVNLASLGNQVPHVHWHVIPRFSNDAHFPL
FT                   PIWAPRQRTVSEAMLSSRRAQATLLREAVRQEIEQALG"
     MDCVFCREDG GDVLWHDDTL RVVLADEHDY PGFCRVIWNG HVAEFSDLDG NDRDRVMKAV        60
     YAVERAIRRI LQPAKVNLAS LGNQVPHVHW HVIPRFSNDA HFPLPIWAPR QRTVSEAMLS       120
     SRRAQATLLR EAVRQEIEQA LG                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page