(data stored in ACNUC7421 zone)

EMBL: CP000270.PE41

CP000270.PE41        Location/Qualifiers
FT   CDS             complement(55810..56088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28579"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B0"
FT                   /protein_id="ABE28579.1"
FT                   /translation="MKRTWNSPTTREIVCKLPAKAEILSIFVRLCALTWGTTINCSAKG
FT                   NNLLQCSFGHLSCSNRREGRVGVAESEKIAKLSAPKENRPKAVLHAK"
     MKRTWNSPTT REIVCKLPAK AEILSIFVRL CALTWGTTIN CSAKGNNLLQ CSFGHLSCSN        60
     RREGRVGVAE SEKIAKLSAP KENRPKAVLH AK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page