(data stored in ACNUC7421 zone)

EMBL: CP000270.PE410

CP000270.PE410       Location/Qualifiers
FT   CDS             457427..457840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4051"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28948"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P1"
FT                   /protein_id="ABE28948.1"
FT                   /translation="MSGLTPDTPVPTGVVVHSKSRVLELQYANGDSYRLPFELLRVYSP
FT                   SAEVMGHGPGQETLQTGKREVTITMIEGVGNYALQPTFSDGHATGIYSWDLLYDMAVRQ
FT                   DELWAAYLAKLQAAGVDRDTPMVQAGAAHGHCH"
     MSGLTPDTPV PTGVVVHSKS RVLELQYANG DSYRLPFELL RVYSPSAEVM GHGPGQETLQ        60
     TGKREVTITM IEGVGNYALQ PTFSDGHATG IYSWDLLYDM AVRQDELWAA YLAKLQAAGV       120
     DRDTPMVQAG AAHGHCH                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page