(data stored in ACNUC7421 zone)

EMBL: CP000270.PE412

CP000270.PE412       Location/Qualifiers
FT   CDS             458677..459669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4049"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28950"
FT                   /db_xref="GOA:Q145N9"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N9"
FT                   /protein_id="ABE28950.1"
FT                   /translation="MSDSGVLSPRKVKRSLVRRIGLIAMVGLIMAGSLASLDAEARRMG
FT                   GGRSIGRQSNSVTQQSAPSQPSQGNQAMQQRAQPAPAPAPAPAAQPNRSRWLGPIAGLA
FT                   AGLGIAALLSHFGLGGAFAGAMANIIVIAIIAMIGIWLIRRFMGRKRDTSQPAYAGGSP
FT                   SLNSSGMGYSQEPRYTAPPTGSYLEPQGNPLSTPAINTAPAVPAGFDSEAFLRNAKVYF
FT                   VRLQAAWDVGNTEDIREFTTPEMFAEVKVDLSSRGAETNQTDVVQLNAELLGVEERANE
FT                   YFASVRFSGLIREAPGAAAEPFVEVWNLSKANRAGEGWLLAGIQQVAQH"
     MSDSGVLSPR KVKRSLVRRI GLIAMVGLIM AGSLASLDAE ARRMGGGRSI GRQSNSVTQQ        60
     SAPSQPSQGN QAMQQRAQPA PAPAPAPAAQ PNRSRWLGPI AGLAAGLGIA ALLSHFGLGG       120
     AFAGAMANII VIAIIAMIGI WLIRRFMGRK RDTSQPAYAG GSPSLNSSGM GYSQEPRYTA       180
     PPTGSYLEPQ GNPLSTPAIN TAPAVPAGFD SEAFLRNAKV YFVRLQAAWD VGNTEDIREF       240
     TTPEMFAEVK VDLSSRGAET NQTDVVQLNA ELLGVEERAN EYFASVRFSG LIREAPGAAA       300
     EPFVEVWNLS KANRAGEGWL LAGIQQVAQH                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page