(data stored in ACNUC7421 zone)

EMBL: CP000270.PE415

CP000270.PE415       Location/Qualifiers
FT   CDS             462084..462707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4046"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28953"
FT                   /db_xref="GOA:Q145N6"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N6"
FT                   /protein_id="ABE28953.1"
FT                   /translation="MSDPTQPAVPDFETRDPNSPAFWDERFERRFTPWDQAGVPAAFQS
FT                   FAARHSGAAVLIPGCGSAYEAVWLAGQGNPVRAIDFSPAAVAAAHEQLGAQHAQLVEQA
FT                   DFFTYEPPFTPAWIYERAFLCALPLARRADYAHRMADLLPGGALLAGFFFLGATPKGPP
FT                   FGIERAELDALLTPYFDLIEDEAVHDSIAVFAGRERWLTWRRRA"
     MSDPTQPAVP DFETRDPNSP AFWDERFERR FTPWDQAGVP AAFQSFAARH SGAAVLIPGC        60
     GSAYEAVWLA GQGNPVRAID FSPAAVAAAH EQLGAQHAQL VEQADFFTYE PPFTPAWIYE       120
     RAFLCALPLA RRADYAHRMA DLLPGGALLA GFFFLGATPK GPPFGIERAE LDALLTPYFD       180
     LIEDEAVHDS IAVFAGRERW LTWRRRA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page