(data stored in ACNUC7421 zone)

EMBL: CP000270.PE416

CP000270.PE416       Location/Qualifiers
FT   CDS             462890..463291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4045"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28954"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N5"
FT                   /protein_id="ABE28954.1"
FT                   /translation="MPIYAYRCESCGFGKDVLQKMSDPQLTQCPECGKDTFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGNGGTSAPAKPDANGASNGASGENAGANNGAAAQSTAAEGGSAA
FT                   AGSSNAAATPSAPAAAPAASASSSGSGSA"
     MPIYAYRCES CGFGKDVLQK MSDPQLTQCP ECGKDTFRKQ VTAAGFQLKG SGWYVTDFRG        60
     GNGGTSAPAK PDANGASNGA SGENAGANNG AAAQSTAAEG GSAAAGSSNA AATPSAPAAA       120
     PAASASSSGS GSA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page