(data stored in ACNUC7421 zone)

EMBL: CP000270.PE428

CP000270.PE428       Location/Qualifiers
FT   CDS             478468..478944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4033"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28966"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M3"
FT                   /protein_id="ABE28966.1"
FT                   /translation="MGLNEAPLLFNFEVESSENFTFIPMSVRFNLDRFGLRISLQQWQL
FT                   LPLEDRKLLARFPVEEDAEIEPNFDHALFEMLRTHANVEPEWFTPEEAPAWRRTDSVPE
FT                   GIAHQAQLAGIAAPGVARWAELAPFKRYVLAKLSRKPEANHDFVPAMKEFGAAG"
     MGLNEAPLLF NFEVESSENF TFIPMSVRFN LDRFGLRISL QQWQLLPLED RKLLARFPVE        60
     EDAEIEPNFD HALFEMLRTH ANVEPEWFTP EEAPAWRRTD SVPEGIAHQA QLAGIAAPGV       120
     ARWAELAPFK RYVLAKLSRK PEANHDFVPA MKEFGAAG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page