(data stored in ACNUC7421 zone)

EMBL: CP000270.PE432

CP000270.PE432       Location/Qualifiers
FT   CDS             484144..484482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28970"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L9"
FT                   /protein_id="ABE28970.1"
FT                   /translation="MTSSPAKKLSVLLASVVLSVACAAPAFAQSGGGGGGPTGSDSDAA
FT                   VPSAASKAAPSTKAQRKAARKQARAKKNAELKKLEANGYQPSRNDPNYPNDIQNAQKKA
FT                   GIGTAASQ"
     MTSSPAKKLS VLLASVVLSV ACAAPAFAQS GGGGGGPTGS DSDAAVPSAA SKAAPSTKAQ        60
     RKAARKQARA KKNAELKKLE ANGYQPSRND PNYPNDIQNA QKKAGIGTAA SQ               112
//

If you have problems or comments...

PBIL Back to PBIL home page