(data stored in ACNUC7421 zone)

EMBL: CP000270.PE436

CP000270.PE436       Location/Qualifiers
FT   CDS             complement(488000..489091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28974"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L5"
FT                   /protein_id="ABE28974.1"
FT                   /translation="MTLPPLQDSTDTRLELLEAWLQGHAARYALELDTLVPASSDASFR
FT                   RYFRLAGKAAEGESGATLIAVDAPPPEKCREFVQVAQLLEAAGVHVPGVLEVDFEAGFM
FT                   LVTDLGTASYLGALTEAQNPDNPQDDPHRARTLMRDALDALIRWQLTSREGVLPPFDEA
FT                   FLRREMELMPEWFLGRHLGREADEKTRGVLDRTFALLIASARAQPQMFMLRDFMPRNLM
FT                   VAAGPAPVNPGVLDFQDAVYGPITYDVASLLRDAFLSWDEEFELDCFVYYWERARKAGL
FT                   PVDPDFGEFYRQLEWMGLQRHIKVLGLFCRINYRDGKPHYMKDLPRFIGYARKVAERYA
FT                   PLRPFARLLDDLEGRANEVGYTF"
     MTLPPLQDST DTRLELLEAW LQGHAARYAL ELDTLVPASS DASFRRYFRL AGKAAEGESG        60
     ATLIAVDAPP PEKCREFVQV AQLLEAAGVH VPGVLEVDFE AGFMLVTDLG TASYLGALTE       120
     AQNPDNPQDD PHRARTLMRD ALDALIRWQL TSREGVLPPF DEAFLRREME LMPEWFLGRH       180
     LGREADEKTR GVLDRTFALL IASARAQPQM FMLRDFMPRN LMVAAGPAPV NPGVLDFQDA       240
     VYGPITYDVA SLLRDAFLSW DEEFELDCFV YYWERARKAG LPVDPDFGEF YRQLEWMGLQ       300
     RHIKVLGLFC RINYRDGKPH YMKDLPRFIG YARKVAERYA PLRPFARLLD DLEGRANEVG       360
     YTF                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page