(data stored in ACNUC7421 zone)

EMBL: CP000270.PE437

CP000270.PE437       Location/Qualifiers
FT   CDS             489314..491683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4024"
FT                   /product="Putative organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28975"
FT                   /db_xref="GOA:Q145L4"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145L4"
FT                   /protein_id="ABE28975.1"
FT                   /translation="MPPRQLSQTTPSCAVVPRKRRLVAALIAVPGLMPALAHAQLVGEA
FT                   AQPQPIDAPWGMQLAPQLEERPLQPGQKPATFVLGDTTSGTTDQDMAAKGSAEVRRNTV
FT                   VIKADALHYDQDTDMADAYGSVHVVNNGNSFVGPEAHMRVDSSEGFMTAPKYHFNVTGG
FT                   SGSAERVDLLDNERSVFTKGTYTACACADDPAWYIKGSEFDFDTGADEGVAHNGVLFFQ
FT                   GFPVFASPWLSFPLSGERRSGVLPPTFSLSSSNGFELSVPYYFNIAPNRDLTLTPRLIS
FT                   KRGVQLQSTFRYLSPTYSGSITGEFLPDDHLTKTNRYALYIQHNQNFGNGFGGYIYYNK
FT                   VSDNTYPEDLSSSVNQFMNGTQLLYQQEAGLTYNNGPWSVLAREQHWQTLTPSVAPYGR
FT                   EPQLNVKYAKYNVGGFDYGAEADYSNFRITTADMTQGQRVMFNPYLSYSVVGPGYFVTP
FT                   KVQWHFASYNLNHLSDADVAAGTPKNFTESIPTLTFDTGLVFDRSVRIFGQDYIQTLEP
FT                   RLYYVYTPYRNQQSAPLFDTADSDFGLAEIFTPNTFVGNDRIADANRLTAALTTRFIDA
FT                   ATGDERARFVIAQQYYFQDQRVTLQSTQTSAQATHSDLIAGASLKLGAGFASETAFQYN
FT                   ADNNQLVKTSVGFGFSPATGKVINVAYRYTRANTTLDNTPINQVLISGQWPLAHRVYGV
FT                   GRFNYDLGGHRIVDGLVGLQYDADCWTLGAGIQRYANGLNTSGQNQSSTRFLAQLTFKG
FT                   LSSVDNGLMTAFRSSVAGYTPLPPPPPPESRFTNYE"
     MPPRQLSQTT PSCAVVPRKR RLVAALIAVP GLMPALAHAQ LVGEAAQPQP IDAPWGMQLA        60
     PQLEERPLQP GQKPATFVLG DTTSGTTDQD MAAKGSAEVR RNTVVIKADA LHYDQDTDMA       120
     DAYGSVHVVN NGNSFVGPEA HMRVDSSEGF MTAPKYHFNV TGGSGSAERV DLLDNERSVF       180
     TKGTYTACAC ADDPAWYIKG SEFDFDTGAD EGVAHNGVLF FQGFPVFASP WLSFPLSGER       240
     RSGVLPPTFS LSSSNGFELS VPYYFNIAPN RDLTLTPRLI SKRGVQLQST FRYLSPTYSG       300
     SITGEFLPDD HLTKTNRYAL YIQHNQNFGN GFGGYIYYNK VSDNTYPEDL SSSVNQFMNG       360
     TQLLYQQEAG LTYNNGPWSV LAREQHWQTL TPSVAPYGRE PQLNVKYAKY NVGGFDYGAE       420
     ADYSNFRITT ADMTQGQRVM FNPYLSYSVV GPGYFVTPKV QWHFASYNLN HLSDADVAAG       480
     TPKNFTESIP TLTFDTGLVF DRSVRIFGQD YIQTLEPRLY YVYTPYRNQQ SAPLFDTADS       540
     DFGLAEIFTP NTFVGNDRIA DANRLTAALT TRFIDAATGD ERARFVIAQQ YYFQDQRVTL       600
     QSTQTSAQAT HSDLIAGASL KLGAGFASET AFQYNADNNQ LVKTSVGFGF SPATGKVINV       660
     AYRYTRANTT LDNTPINQVL ISGQWPLAHR VYGVGRFNYD LGGHRIVDGL VGLQYDADCW       720
     TLGAGIQRYA NGLNTSGQNQ SSTRFLAQLT FKGLSSVDNG LMTAFRSSVA GYTPLPPPPP       780
     PESRFTNYE                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page