(data stored in ACNUC7421 zone)

EMBL: CP000270.PE45

CP000270.PE45        Location/Qualifiers
FT   CDS             complement(60788..62053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4417"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28583"
FT                   /db_xref="GOA:Q147A6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A6"
FT                   /protein_id="ABE28583.1"
FT                   /translation="MRTLPATDIELAAWLRLSLAPGLKPAALRLLLCAFGLPEAIFDQA
FT                   PEALAAIAGEAAARAALAPTGPEFDAQLDAVIAWREQPGNQIVTLDDPAYPPALLTMPD
FT                   PPPLLYIKGRLNLLHTRAVALVGSRSATPQGVEDAERFARELSVAGVTVISGLALGIDG
FT                   AAHRGGLEGVGSTVAVIGTGADLVYPSAHHALARQIAVQGAILSEWPLGTPARAANFPQ
FT                   RNRLIAGLVSGVVIVEAAMRSGSLITARLANEMGRDVFALPGSIHAPLSRGCHRIIKQG
FT                   AKLVETPDEVLEELGFTRREAPRAASGPAHAILWNDAGSGKAPAVNGATTVRPKPATAQ
FT                   TAETSAADSATAPNPAPAHRPVDPEAERLLTALGHSPTTLEILATRTEMEDATLQSTLL
FT                   QLELAGQVTVLPGGRFMRASHG"
     MRTLPATDIE LAAWLRLSLA PGLKPAALRL LLCAFGLPEA IFDQAPEALA AIAGEAAARA        60
     ALAPTGPEFD AQLDAVIAWR EQPGNQIVTL DDPAYPPALL TMPDPPPLLY IKGRLNLLHT       120
     RAVALVGSRS ATPQGVEDAE RFARELSVAG VTVISGLALG IDGAAHRGGL EGVGSTVAVI       180
     GTGADLVYPS AHHALARQIA VQGAILSEWP LGTPARAANF PQRNRLIAGL VSGVVIVEAA       240
     MRSGSLITAR LANEMGRDVF ALPGSIHAPL SRGCHRIIKQ GAKLVETPDE VLEELGFTRR       300
     EAPRAASGPA HAILWNDAGS GKAPAVNGAT TVRPKPATAQ TAETSAADSA TAPNPAPAHR       360
     PVDPEAERLL TALGHSPTTL EILATRTEME DATLQSTLLQ LELAGQVTVL PGGRFMRASH       420
     G                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page