(data stored in ACNUC7421 zone)

EMBL: CP000270.PE457

CP000270.PE457       Location/Qualifiers
FT   CDS             complement(511954..512337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4004"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28995"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J4"
FT                   /protein_id="ABE28995.1"
FT                   /translation="MSTSSKVVAWFEIPSVDFDRAVRFYEAALDVKLNVQEIGGQPIAV
FT                   FGYEEPATGGAIVHSPSMTPTGDGVLVYLNAQPNVDATLARVEKAGGKTDGPVIKLPQD
FT                   IGYIAFFTDTEGNRLGLHSRTNG"
     MSTSSKVVAW FEIPSVDFDR AVRFYEAALD VKLNVQEIGG QPIAVFGYEE PATGGAIVHS        60
     PSMTPTGDGV LVYLNAQPNV DATLARVEKA GGKTDGPVIK LPQDIGYIAF FTDTEGNRLG       120
     LHSRTNG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page