(data stored in ACNUC7421 zone)

EMBL: CP000270.PE458

CP000270.PE458       Location/Qualifiers
FT   CDS             complement(512576..513868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4003"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28996"
FT                   /db_xref="GOA:Q145J3"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J3"
FT                   /protein_id="ABE28996.1"
FT                   /translation="MSFDFFLPCPRGLEASLAAELAEIAAQHLNGAPFTAGAQVPGGVH
FT                   FRGGWAAGMAANLHSRLASRVLLKVAHRPYRSEQDIYALAVEQRWEQWFSANETLRVDV
FT                   TAIKSPLRSLEFTTLRVKDAICDRLREVSGARPSIDTAMPDVRVFAFLTATDCTLYLDT
FT                   SGDPLFKRGWRLDKGAAPLRENLAAGILRLTGWTAGTPLYDPMCGSGTFLAEAAQVALN
FT                   IAPGAERRFGFEKLKQYEAKTWQTLKAAALDAKHAARNSRADLQIFGSDISGDMLDKAR
FT                   ANFQRAGLPSIPLKQLDARNMTPPSSAAGILVANPPYGERIEVRGRNARGELREGRGNR
FT                   DSREDDGFRRAQEETPDSEFFQSLGDALKQRFTGWHAFILTSDRKLPGQLRLRESTKTP
FT                   LFNGALECRLFRFDLIAGSVRQRPQTDTPAA"
     MSFDFFLPCP RGLEASLAAE LAEIAAQHLN GAPFTAGAQV PGGVHFRGGW AAGMAANLHS        60
     RLASRVLLKV AHRPYRSEQD IYALAVEQRW EQWFSANETL RVDVTAIKSP LRSLEFTTLR       120
     VKDAICDRLR EVSGARPSID TAMPDVRVFA FLTATDCTLY LDTSGDPLFK RGWRLDKGAA       180
     PLRENLAAGI LRLTGWTAGT PLYDPMCGSG TFLAEAAQVA LNIAPGAERR FGFEKLKQYE       240
     AKTWQTLKAA ALDAKHAARN SRADLQIFGS DISGDMLDKA RANFQRAGLP SIPLKQLDAR       300
     NMTPPSSAAG ILVANPPYGE RIEVRGRNAR GELREGRGNR DSREDDGFRR AQEETPDSEF       360
     FQSLGDALKQ RFTGWHAFIL TSDRKLPGQL RLRESTKTPL FNGALECRLF RFDLIAGSVR       420
     QRPQTDTPAA                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page