(data stored in ACNUC7421 zone)

EMBL: CP000270.PE459

CP000270.PE459       Location/Qualifiers
FT   CDS             complement(514000..516168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4002"
FT                   /product="Putative site-specific recombinase transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28997"
FT                   /db_xref="GOA:Q145J2"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J2"
FT                   /protein_id="ABE28997.1"
FT                   /translation="MFDSLRRFIRKWRASRDGGHQLDALLAIADRTAPYPERSEWLIEL
FT                   AHWIRRGHAVEAGAAAAGDNAHHSTPTHTRIRYLLHVLDRNPVWKGNVAGILRALLRES
FT                   DGLSLLCDAGMPVHSGFFGALFERLEAALIPPAPNRRDLTAIVTLMFSSERDAEWIGAL
FT                   PTDLLIRIHALFDYAADEDEQRDTTPFSLDLLAALHNLTCQISSTGLSQTVRSRLGRAD
FT                   PDERGSAHAHRDRDGHAAHEASDVRVAMEKQPFYRLTRAMLAVETVHQAFVAGGPQEPL
FT                   LHEVNYLRLLLDECRGATDNVFAHLYRNGVSVDIVFQVERMRMRIVRAEHLLNAWMAQD
FT                   DPHAGARLTAELVNANHASQSVAHLVRSNFSLLARKVVEYSADTGEHYIARDRAEYLKM
FT                   LRMAAGGGLVTVVTVCVKFAITGAHFQAMFEGLLAGINYAASFLLMHFLHFSLATKQPA
FT                   MTAPTLARELDGVGTPAGVDSFVSSVTALMRTQAAAVLGNVLLVFPVCFGVQLLWHALF
FT                   RANIISPEKAHATLHSFSLWGPTPFYAALTGVLLWSSSLLAGWADNWFVLHRVADALTY
FT                   NRRLRMTLGAAGAERIARFCRANVARVVGNITLGLMLGLVPAILTAFAFSFEVRHVTLS
FT                   AGSIGVALGVLGKDALKLPELWWAVAGVGSMAILNVAVSFALAFYMAVKSRDLRRNAVR
FT                   SLRGAIWQRLFRHPLELVWPAKAARAAR"
     MFDSLRRFIR KWRASRDGGH QLDALLAIAD RTAPYPERSE WLIELAHWIR RGHAVEAGAA        60
     AAGDNAHHST PTHTRIRYLL HVLDRNPVWK GNVAGILRAL LRESDGLSLL CDAGMPVHSG       120
     FFGALFERLE AALIPPAPNR RDLTAIVTLM FSSERDAEWI GALPTDLLIR IHALFDYAAD       180
     EDEQRDTTPF SLDLLAALHN LTCQISSTGL SQTVRSRLGR ADPDERGSAH AHRDRDGHAA       240
     HEASDVRVAM EKQPFYRLTR AMLAVETVHQ AFVAGGPQEP LLHEVNYLRL LLDECRGATD       300
     NVFAHLYRNG VSVDIVFQVE RMRMRIVRAE HLLNAWMAQD DPHAGARLTA ELVNANHASQ       360
     SVAHLVRSNF SLLARKVVEY SADTGEHYIA RDRAEYLKML RMAAGGGLVT VVTVCVKFAI       420
     TGAHFQAMFE GLLAGINYAA SFLLMHFLHF SLATKQPAMT APTLARELDG VGTPAGVDSF       480
     VSSVTALMRT QAAAVLGNVL LVFPVCFGVQ LLWHALFRAN IISPEKAHAT LHSFSLWGPT       540
     PFYAALTGVL LWSSSLLAGW ADNWFVLHRV ADALTYNRRL RMTLGAAGAE RIARFCRANV       600
     ARVVGNITLG LMLGLVPAIL TAFAFSFEVR HVTLSAGSIG VALGVLGKDA LKLPELWWAV       660
     AGVGSMAILN VAVSFALAFY MAVKSRDLRR NAVRSLRGAI WQRLFRHPLE LVWPAKAARA       720
     AR                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page