(data stored in ACNUC7421 zone)

EMBL: CP000270.PE46

CP000270.PE46        Location/Qualifiers
FT   CDS             62298..62801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4416"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28584"
FT                   /db_xref="GOA:Q147A5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A5"
FT                   /protein_id="ABE28584.1"
FT                   /translation="MALLNIINYPDKRLHKIAKPVEAVNDRIRRLVKDMAETMYAAPGV
FT                   GLAATQVDVHERVIVIDVSDDHNELLTFINPEIIWSSDERKLSEEGCLSVPGIYDNVER
FT                   AEKVRVRALNEKGETFEMDCEGLLAVCIQHEMDHLMGRVFVEYLSSLKQTRIKSKMKKL
FT                   AHAM"
     MALLNIINYP DKRLHKIAKP VEAVNDRIRR LVKDMAETMY AAPGVGLAAT QVDVHERVIV        60
     IDVSDDHNEL LTFINPEIIW SSDERKLSEE GCLSVPGIYD NVERAEKVRV RALNEKGETF       120
     EMDCEGLLAV CIQHEMDHLM GRVFVEYLSS LKQTRIKSKM KKLAHAM                     167
//

If you have problems or comments...

PBIL Back to PBIL home page