(data stored in ACNUC7421 zone)

EMBL: CP000270.PE460

CP000270.PE460       Location/Qualifiers
FT   CDS             complement(516170..516922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4001"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28998"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J1"
FT                   /protein_id="ABE28998.1"
FT                   /translation="MMFARLPRPPRGLARGAVLAGALAGLVALAACSSPSSRFYTLGSD
FT                   STAAAAAPVSGRTPAAPAWLIEVAPIDVPPQVSKNQLVVQTGPTQVKVLEEERWASLPG
FT                   DEIRRALSTSLTQQLNTIDVYGTARPDATPVYRVGMNVQRFESWPGSHALIDAVWSVRS
FT                   VRSNAVMTCRSVVSAPVSGGYDALVDGHRQALQRISVQIASAVQAMAAAAPQGQGTRGA
FT                   ASASTKGTAVSVAVPPCPSADSTAGAGA"
     MMFARLPRPP RGLARGAVLA GALAGLVALA ACSSPSSRFY TLGSDSTAAA AAPVSGRTPA        60
     APAWLIEVAP IDVPPQVSKN QLVVQTGPTQ VKVLEEERWA SLPGDEIRRA LSTSLTQQLN       120
     TIDVYGTARP DATPVYRVGM NVQRFESWPG SHALIDAVWS VRSVRSNAVM TCRSVVSAPV       180
     SGGYDALVDG HRQALQRISV QIASAVQAMA AAAPQGQGTR GAASASTKGT AVSVAVPPCP       240
     SADSTAGAGA                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page