(data stored in ACNUC7421 zone)

EMBL: CP000270.PE461

CP000270.PE461       Location/Qualifiers
FT   CDS             complement(516919..518577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4000"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4000"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28999"
FT                   /db_xref="GOA:Q145J0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J0"
FT                   /protein_id="ABE28999.1"
FT                   /translation="MTSPQEPTPAPDAPRNDSNGPKLPPQLPDPDIEPRSRWLPSLVWV
FT                   IPLIAALIGIALVIKSVTARGPTITISFVSAEGLEPGKTKVKYKDVDVGAVKTITLSKD
FT                   LSHVLVQVQLTKEGEDFAVKDSRFWVVRPRVGASGVSGLTTLLSGAYIGADAGHSPDTE
FT                   KNFVGLETPPPITGDQKGHQFILHGDSLGSIDIGSPIFYRRVQVGQVVGFSLDKDGTGV
FT                   TMQVFVSAPFDQYVGTNSRWWHASGVDLRLDSSGFKLNTQSLATVIVGGLSFQSPPGQG
FT                   VGAQAPNNMTFRLGSDEADAMREPDGVPLRVVMNFNQSLRGLSIGAPVDFRGIVLGQVT
FT                   NIGIDYDPKTRSFTMPVTMNLYPDRLGRRFRETAPAPGSLAGQTMLQQLVKHGLRGQLR
FT                   TGNLITSQLYVAVDIFPKAPPATVDVASDPLELPTIPNTLDELQLQVADIAKKLDAVPF
FT                   DQIGNNLNSALKNADQLFTRLDKEVVPQARDTLAAAKQTFGSAEATLQQDSPLQSDVHQ
FT                   ALQELTRTLQSLNALSDYLERHPESLLRGKSGDKP"
     MTSPQEPTPA PDAPRNDSNG PKLPPQLPDP DIEPRSRWLP SLVWVIPLIA ALIGIALVIK        60
     SVTARGPTIT ISFVSAEGLE PGKTKVKYKD VDVGAVKTIT LSKDLSHVLV QVQLTKEGED       120
     FAVKDSRFWV VRPRVGASGV SGLTTLLSGA YIGADAGHSP DTEKNFVGLE TPPPITGDQK       180
     GHQFILHGDS LGSIDIGSPI FYRRVQVGQV VGFSLDKDGT GVTMQVFVSA PFDQYVGTNS       240
     RWWHASGVDL RLDSSGFKLN TQSLATVIVG GLSFQSPPGQ GVGAQAPNNM TFRLGSDEAD       300
     AMREPDGVPL RVVMNFNQSL RGLSIGAPVD FRGIVLGQVT NIGIDYDPKT RSFTMPVTMN       360
     LYPDRLGRRF RETAPAPGSL AGQTMLQQLV KHGLRGQLRT GNLITSQLYV AVDIFPKAPP       420
     ATVDVASDPL ELPTIPNTLD ELQLQVADIA KKLDAVPFDQ IGNNLNSALK NADQLFTRLD       480
     KEVVPQARDT LAAAKQTFGS AEATLQQDSP LQSDVHQALQ ELTRTLQSLN ALSDYLERHP       540
     ESLLRGKSGD KP                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page