(data stored in ACNUC7421 zone)

EMBL: CP000270.PE462

CP000270.PE462       Location/Qualifiers
FT   CDS             complement(518570..519220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3999"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3999"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29000"
FT                   /db_xref="GOA:Q145I9"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I9"
FT                   /protein_id="ABE29000.1"
FT                   /translation="MKYVTARSAGLVSCHACGRVEPRIRSVTAQHCSRCGAHLHSRNPD
FT                   SLMRTWALLIAAALLYIPANLLPVMHTSSLLGSEDDTIMSGVVYFWTSGDWPLAVIVFV
FT                   ASIMVPMLKLSVLVLLTITAQRRSRWRPDQRITLYRMVERIGRWSMLDVFVVTLTVALV
FT                   RFKSLAVITAGPGAIAFGSVVILTMMASMQFDPRLIWDHVEGSTPKPQDLKHD"
     MKYVTARSAG LVSCHACGRV EPRIRSVTAQ HCSRCGAHLH SRNPDSLMRT WALLIAAALL        60
     YIPANLLPVM HTSSLLGSED DTIMSGVVYF WTSGDWPLAV IVFVASIMVP MLKLSVLVLL       120
     TITAQRRSRW RPDQRITLYR MVERIGRWSM LDVFVVTLTV ALVRFKSLAV ITAGPGAIAF       180
     GSVVILTMMA SMQFDPRLIW DHVEGSTPKP QDLKHD                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page