(data stored in ACNUC7421 zone)

EMBL: CP000270.PE463

CP000270.PE463       Location/Qualifiers
FT   CDS             complement(519228..519983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3998"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3998"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29001"
FT                   /db_xref="GOA:Q145I8"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I8"
FT                   /protein_id="ABE29001.1"
FT                   /translation="MEHDNLIACHECDTLFRKPRLVGRTVARCPRCGATLYRGISRRLD
FT                   AVSAMTLGALITFLIAQGFPIVELETNGITSQTTLFGALIALWDEDMQIVAVMVFCSTI
FT                   LFPLTELVALLYVLIPLRAGYVPHAFNRVLRAIQFVRPWGMIEVFMLGILITIVKMVSL
FT                   ARVIPEAALFAFGVLTLMLAVVVTFDPRILWDLADELGARDQRPLPRTSADSAAAALNS
FT                   VAGPPAPPEVLGAEPSALPPVVPPAPRRG"
     MEHDNLIACH ECDTLFRKPR LVGRTVARCP RCGATLYRGI SRRLDAVSAM TLGALITFLI        60
     AQGFPIVELE TNGITSQTTL FGALIALWDE DMQIVAVMVF CSTILFPLTE LVALLYVLIP       120
     LRAGYVPHAF NRVLRAIQFV RPWGMIEVFM LGILITIVKM VSLARVIPEA ALFAFGVLTL       180
     MLAVVVTFDP RILWDLADEL GARDQRPLPR TSADSAAAAL NSVAGPPAPP EVLGAEPSAL       240
     PPVVPPAPRR G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page