(data stored in ACNUC7421 zone)

EMBL: CP000270.PE465

CP000270.PE465       Location/Qualifiers
FT   CDS             520990..521553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3996"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3996"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29003"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I6"
FT                   /protein_id="ABE29003.1"
FT                   /translation="MKVSFYRYMLAAFAAASLTVAGSALAQVDVAKSSVTATSKQMNVP
FT                   VEGKFGKFTAQVRFDPAKPAEGSAQFSIDVASYDLGDESYNDQVRGKDWFDAKTYPSAT
FT                   FVSSAIAPAGGNQFKVTGKLTIKGKSQTVVVPVTVAQQGAMQIFDGSLPIKRSQFDIGT
FT                   GEWKDTSVVADEVVIKFHIVAARK"
     MKVSFYRYML AAFAAASLTV AGSALAQVDV AKSSVTATSK QMNVPVEGKF GKFTAQVRFD        60
     PAKPAEGSAQ FSIDVASYDL GDESYNDQVR GKDWFDAKTY PSATFVSSAI APAGGNQFKV       120
     TGKLTIKGKS QTVVVPVTVA QQGAMQIFDG SLPIKRSQFD IGTGEWKDTS VVADEVVIKF       180
     HIVAARK                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page