(data stored in ACNUC7421 zone)

EMBL: CP000270.PE466

CP000270.PE466       Location/Qualifiers
FT   CDS             521620..522189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3995"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3995"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29004"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I5"
FT                   /protein_id="ABE29004.1"
FT                   /translation="MLIAFGALASSFSLGAFAAADTYQLDPTHTYPSFEADHFGGLSVW
FT                   RGKFTKSSGTVTLDRAAKTGTVDVTVDPASVDTGNGKLDEHLKSDAFFDVAKYPSVTYK
FT                   GTDIRFDGDKPVEVIGNLTIRGITKPLNLKIESFKCMQHPVLKREVCGVEASAHFNRAD
FT                   YGMDFGVKYGFSMDTKLHIQSEGIRQ"
     MLIAFGALAS SFSLGAFAAA DTYQLDPTHT YPSFEADHFG GLSVWRGKFT KSSGTVTLDR        60
     AAKTGTVDVT VDPASVDTGN GKLDEHLKSD AFFDVAKYPS VTYKGTDIRF DGDKPVEVIG       120
     NLTIRGITKP LNLKIESFKC MQHPVLKREV CGVEASAHFN RADYGMDFGV KYGFSMDTKL       180
     HIQSEGIRQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page