(data stored in ACNUC7421 zone)

EMBL: CP000270.PE470

CP000270.PE470       Location/Qualifiers
FT   CDS             complement(527062..527424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3991"
FT                   /product="protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3991"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29008"
FT                   /db_xref="GOA:Q145I1"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I1"
FT                   /protein_id="ABE29008.1"
FT                   /translation="MIVLTYNGETNVSFISNAFAQGTATGGIESNLMSFLPLILMFGVL
FT                   YFIMIRPQMKRQKEHRNMLAAMAKGDEVVTNGGIVGKVTKVGEAYVGVEISEGTEITVQ
FT                   KASVTTILPKGTIKSL"
     MIVLTYNGET NVSFISNAFA QGTATGGIES NLMSFLPLIL MFGVLYFIMI RPQMKRQKEH        60
     RNMLAAMAKG DEVVTNGGIV GKVTKVGEAY VGVEISEGTE ITVQKASVTT ILPKGTIKSL       120
//

If you have problems or comments...

PBIL Back to PBIL home page