(data stored in ACNUC7421 zone)

EMBL: CP000270.PE477

CP000270.PE477       Location/Qualifiers
FT   CDS             535940..536437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3984"
FT                   /product="Putative ferritin DPS-family DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3984"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29015"
FT                   /db_xref="GOA:Q145H4"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H4"
FT                   /protein_id="ABE29015.1"
FT                   /translation="MAKKEASAAVQHVNIGISDKDRKKIAEGLSRLLADTYTLYLKTHN
FT                   FHWNVTGPMFNTLHLMFETQYNELALAVDSIAERIRALGVHAPGSYKEFARLSSIPEAD
FT                   GVPAAEEMIRQLVEGQEAVVRTARAIFPSTEAANDEPTADLLTQRMQTHEKTAWMLRSM
FT                   LA"
     MAKKEASAAV QHVNIGISDK DRKKIAEGLS RLLADTYTLY LKTHNFHWNV TGPMFNTLHL        60
     MFETQYNELA LAVDSIAERI RALGVHAPGS YKEFARLSSI PEADGVPAAE EMIRQLVEGQ       120
     EAVVRTARAI FPSTEAANDE PTADLLTQRM QTHEKTAWML RSMLA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page