(data stored in ACNUC7421 zone)

EMBL: CP000270.PE48

CP000270.PE48        Location/Qualifiers
FT   CDS             63933..64574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4414"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28586"
FT                   /db_xref="GOA:Q147A3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A3"
FT                   /protein_id="ABE28586.1"
FT                   /translation="MFGITHFEFFVVAVFLLNVTPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHSLACAFGLTALLAASAAAFTVIKFAGAIYLIYLGVRLIFAKPAADQAAGE
FT                   ARAAGAPKSLRQLFLQGFWTNVLNPKVVLFFVSFFPQFVALGSDHKALAFLTLGAVFVV
FT                   MSTLWNSLVAWVAGSVTRRFSGRPLVKQWLDRGVGGAFVGLGIKLATASR"
     MFGITHFEFF VVAVFLLNVT PGPDTAYIVG RSVAQGRGAG LMSALGISAG CCVHSLACAF        60
     GLTALLAASA AAFTVIKFAG AIYLIYLGVR LIFAKPAADQ AAGEARAAGA PKSLRQLFLQ       120
     GFWTNVLNPK VVLFFVSFFP QFVALGSDHK ALAFLTLGAV FVVMSTLWNS LVAWVAGSVT       180
     RRFSGRPLVK QWLDRGVGGA FVGLGIKLAT ASR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page