(data stored in ACNUC7421 zone)

EMBL: CP000270.PE487

CP000270.PE487       Location/Qualifiers
FT   CDS             complement(545928..546272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3974"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3974"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29025"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G4"
FT                   /protein_id="ABE29025.1"
FT                   /translation="MEQEKEIRWLGSSYHDLLAFPEEMRRRAGFQLGKIQAGLDPDDWK
FT                   PFDSIGPGTREIRIREADGVFRVMYVTKFVEALYVLHCFQKKTQRLGPHDRKIAETRYR
FT                   AIINNRKTEK"
     MEQEKEIRWL GSSYHDLLAF PEEMRRRAGF QLGKIQAGLD PDDWKPFDSI GPGTREIRIR        60
     EADGVFRVMY VTKFVEALYV LHCFQKKTQR LGPHDRKIAE TRYRAIINNR KTEK             114
//

If you have problems or comments...

PBIL Back to PBIL home page