(data stored in ACNUC7421 zone)

EMBL: CP000270.PE490

CP000270.PE490       Location/Qualifiers
FT   CDS             complement(549493..550317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3971"
FT                   /product="Putative carbon-nitrogen hydrolase protein"
FT                   /EC_number="3.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3971"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29028"
FT                   /db_xref="GOA:Q145G1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G1"
FT                   /protein_id="ABE29028.1"
FT                   /translation="MSSGSLESAFRVAALQMVSTPDRERNLAEAGRLIAEAAAEGAQLV
FT                   LLPEYFCFMGFKDTDKLAVREPYQDGPIQRFLADAARRHQIWVIGGTLPLMSPEASRVL
FT                   NTTLVFDPQGNEAARYDKIHLFNFEKGAESFDEARTICPGGEVRSFEAPFGRVGLSVCY
FT                   DLRFPELYRRMGDCALIVVPSAFTYTTGRAHWEMLLRARAVENQCYVLAAAQGGKHENG
FT                   RRTWGHSMLIDPWGEIVALRDEGAGVVAGNLERARIDEVRQSLPAWRHRVLS"
     MSSGSLESAF RVAALQMVST PDRERNLAEA GRLIAEAAAE GAQLVLLPEY FCFMGFKDTD        60
     KLAVREPYQD GPIQRFLADA ARRHQIWVIG GTLPLMSPEA SRVLNTTLVF DPQGNEAARY       120
     DKIHLFNFEK GAESFDEART ICPGGEVRSF EAPFGRVGLS VCYDLRFPEL YRRMGDCALI       180
     VVPSAFTYTT GRAHWEMLLR ARAVENQCYV LAAAQGGKHE NGRRTWGHSM LIDPWGEIVA       240
     LRDEGAGVVA GNLERARIDE VRQSLPAWRH RVLS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page