(data stored in ACNUC7421 zone)

EMBL: CP000270.PE493

CP000270.PE493       Location/Qualifiers
FT   CDS             complement(557704..559374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3968"
FT                   /product="DNA replication and repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3968"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29031"
FT                   /db_xref="GOA:Q145F8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145F8"
FT                   /protein_id="ABE29031.1"
FT                   /translation="MLRHLSIRDFVIVAALDLEFDSGFTVFSGETGAGKSILIDALALA
FT                   LGARADANVVRTGESRADITAEFETHAQVEQWLDEQALGTTGSDGHHGSTVMLRRVVDG
FT                   NGRSRAFINGTAATLAQLREVGEMLVDIHGQHAHQLLMRPDAQRELFDTHAGLSDTAAA
FT                   VTRAWRAWREKVQAVEHAQTRDRELQLERERLAWQLAELDKLAPQPGEWEEVNSEHRRL
FT                   SHSANLIDGVQGALGALSESDEAMITHLSSIVSKVRDLAEVDPALNDVLAALEPAEIQL
FT                   QEAAYSLSHYAQKLELDPDRLAQVEKRLDALHSAARKFRLQPQTLPEEHEARRAQLAAL
FT                   DAAADLDSLHAAEAKAKEHFLTEAKKLSKARAKAGKALGAAVTTGMQELSMKGGSFEVA
FT                   LVPQPEGGAHGLEQVEFRVAGHAGVPLRPLAKVASGGELARISLALAVIASAASPTPTL
FT                   IFDEVDTGIGGGVAEVVGRLLHQLGQQRQVLCVTHLPQVAARGDHHFQVAKAGNGKGGT
FT                   ISSVTSLDKASRIEEVARMLGGLEITPTTRKHAKEMLAA"
     MLRHLSIRDF VIVAALDLEF DSGFTVFSGE TGAGKSILID ALALALGARA DANVVRTGES        60
     RADITAEFET HAQVEQWLDE QALGTTGSDG HHGSTVMLRR VVDGNGRSRA FINGTAATLA       120
     QLREVGEMLV DIHGQHAHQL LMRPDAQREL FDTHAGLSDT AAAVTRAWRA WREKVQAVEH       180
     AQTRDRELQL ERERLAWQLA ELDKLAPQPG EWEEVNSEHR RLSHSANLID GVQGALGALS       240
     ESDEAMITHL SSIVSKVRDL AEVDPALNDV LAALEPAEIQ LQEAAYSLSH YAQKLELDPD       300
     RLAQVEKRLD ALHSAARKFR LQPQTLPEEH EARRAQLAAL DAAADLDSLH AAEAKAKEHF       360
     LTEAKKLSKA RAKAGKALGA AVTTGMQELS MKGGSFEVAL VPQPEGGAHG LEQVEFRVAG       420
     HAGVPLRPLA KVASGGELAR ISLALAVIAS AASPTPTLIF DEVDTGIGGG VAEVVGRLLH       480
     QLGQQRQVLC VTHLPQVAAR GDHHFQVAKA GNGKGGTISS VTSLDKASRI EEVARMLGGL       540
     EITPTTRKHA KEMLAA                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page