(data stored in ACNUC7421 zone)

EMBL: CP000270.PE494

CP000270.PE494       Location/Qualifiers
FT   CDS             complement(559446..560348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3967"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3967"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29032"
FT                   /db_xref="GOA:Q145F7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F7"
FT                   /protein_id="ABE29032.1"
FT                   /translation="MQVTSQFKTVALVGRNNTPGIAEPLTALALCIAKRGFEVVFEADT
FT                   AAEIGVTDYPALRPAEIGARADVAVVLGGDGTMLGIGRQLAPYRTPLIGINHGRLGFIT
FT                   DIPISDMREIVPQMLAGNFEREERVLLEARIMRDGNPIYHALAFNDVVVNRSGFSGMAE
FT                   LHVSVDGRFMYNQRSDGLIVATPTGSTAYALSSQGPILHPQLQGIVLVPIAPHALSNRP
FT                   IVLPDDSKVSIQIVSGREVNVNFDMQSFTSLELSDTIEVRRSRHTVPMLHPVGYSYFAT
FT                   LRKKLHWNEYPSHEEDPKP"
     MQVTSQFKTV ALVGRNNTPG IAEPLTALAL CIAKRGFEVV FEADTAAEIG VTDYPALRPA        60
     EIGARADVAV VLGGDGTMLG IGRQLAPYRT PLIGINHGRL GFITDIPISD MREIVPQMLA       120
     GNFEREERVL LEARIMRDGN PIYHALAFND VVVNRSGFSG MAELHVSVDG RFMYNQRSDG       180
     LIVATPTGST AYALSSQGPI LHPQLQGIVL VPIAPHALSN RPIVLPDDSK VSIQIVSGRE       240
     VNVNFDMQSF TSLELSDTIE VRRSRHTVPM LHPVGYSYFA TLRKKLHWNE YPSHEEDPKP       300
//

If you have problems or comments...

PBIL Back to PBIL home page