(data stored in ACNUC7421 zone)

EMBL: CP000270.PE497

CP000270.PE497       Location/Qualifiers
FT   CDS             562940..563347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3964"
FT                   /product="heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3964"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29035"
FT                   /db_xref="GOA:Q145F4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q145F4"
FT                   /protein_id="ABE29035.1"
FT                   /translation="MNYGISTEAGAKLRIDKWLWAARFFKTRSLAAAAVEKGHVRIEGA
FT                   SVKPAKDVRVGDLVEIEIERIVWQVAVLGVCDVRGPASVAQTLYAETEESRVKRQVEQE
FT                   RRKTYREPAAALHGRPTKRDRRTIDKLSGGG"
     MNYGISTEAG AKLRIDKWLW AARFFKTRSL AAAAVEKGHV RIEGASVKPA KDVRVGDLVE        60
     IEIERIVWQV AVLGVCDVRG PASVAQTLYA ETEESRVKRQ VEQERRKTYR EPAAALHGRP       120
     TKRDRRTIDK LSGGG                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page