(data stored in ACNUC7421 zone)

EMBL: CP000270.PE498

CP000270.PE498       Location/Qualifiers
FT   CDS             563867..564451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3963"
FT                   /product="Putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3963"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29036"
FT                   /db_xref="GOA:Q145F3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F3"
FT                   /protein_id="ABE29036.1"
FT                   /translation="MENTQENPTSQNPKPAEETARQAAEAAAPQQEAAANAATDSPASA
FT                   EQAALAEAQAKIAELQESFLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPVIDSL
FT                   EAAVAHSSDDPAKVREGVELTLRQLTGALEKGRVVALNPVGEKFDPHRHQAISMVPADQ
FT                   EPNTVVAVLQKGFVIADRVLRPALVTVAAPK"
     MENTQENPTS QNPKPAEETA RQAAEAAAPQ QEAAANAATD SPASAEQAAL AEAQAKIAEL        60
     QESFLRAKAE TENVRRRAQE DVAKAHKFAI ESFAEHLLPV IDSLEAAVAH SSDDPAKVRE       120
     GVELTLRQLT GALEKGRVVA LNPVGEKFDP HRHQAISMVP ADQEPNTVVA VLQKGFVIAD       180
     RVLRPALVTV AAPK                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page