(data stored in ACNUC7421 zone)

EMBL: CP000270.PE499

CP000270.PE499       Location/Qualifiers
FT   CDS             564497..564943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3962"
FT                   /product="Putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3962"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29037"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q145F2"
FT                   /protein_id="ABE29037.1"
FT                   /translation="MANIPVDSTAFAVFGMQELSAASFDAALAEAGDELAVVFFWGLDC
FT                   FNCEIAKKAMLAQPDAIRALGLKWFHSNVYEHRELGRRFMLHGVPTWFFFYRGKRLGRA
FT                   TGWHGLGQFQAAVAAAREKIRAGNAANAAGGHIEAADSGGSSPD"
     MANIPVDSTA FAVFGMQELS AASFDAALAE AGDELAVVFF WGLDCFNCEI AKKAMLAQPD        60
     AIRALGLKWF HSNVYEHREL GRRFMLHGVP TWFFFYRGKR LGRATGWHGL GQFQAAVAAA       120
     REKIRAGNAA NAAGGHIEAA DSGGSSPD                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page