(data stored in ACNUC7421 zone)

EMBL: CP000270.PE5

CP000270.PE5         Location/Qualifiers
FT   CDS             complement(8140..8388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28543"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E6"
FT                   /protein_id="ABE28543.1"
FT                   /translation="MLYVRRQRRIPKIRYFLDHCSCKRFRQNEIALEAMHVSFDLFRKY
FT                   ESATGREEGASDKARARSKERCPPGRRRYPLSSRRLS"
     MLYVRRQRRI PKIRYFLDHC SCKRFRQNEI ALEAMHVSFD LFRKYESATG REEGASDKAR        60
     ARSKERCPPG RRRYPLSSRR LS                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page