(data stored in ACNUC7421 zone)

EMBL: CP000270.PE501

CP000270.PE501       Location/Qualifiers
FT   CDS             567331..568473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3960"
FT                   /product="Putative DnaJ chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3960"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29039"
FT                   /db_xref="GOA:Q145F0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F0"
FT                   /protein_id="ABE29039.1"
FT                   /translation="MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEG
FT                   HFKEVKEAYEMLSDSQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFGDIFGDIFGQA
FT                   AGGAARGGGGRAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKP
FT                   GTKPETCPTCSGSGSVRMSQGFFSIQQTCPKCHGTGTYIPDPCGHCHGAGKVKETKTLE
FT                   VKIPAGIDDGMRIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFT
FT                   TAALGGEIEVPTLAGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPV
FT                   KLTEPQRDLLKQFEKALVEGGSRHSPQSKSWFDRVKSFFD"
     MAKRDYYEVL GVAKNASDDE IKKAYRKLAM KHHPDRNPGN KDAEGHFKEV KEAYEMLSDS        60
     QKRAAYDQYG HAGVDPNMGG AGAQGFGGFA DAFGDIFGDI FGQAAGGAAR GGGGRAGPQV       120
     YRGADLRYSM EITLEQAAHG YDTQIRVPSW VSCEVCHGSG AKPGTKPETC PTCSGSGSVR       180
     MSQGFFSIQQ TCPKCHGTGT YIPDPCGHCH GAGKVKETKT LEVKIPAGID DGMRIRSAGN       240
     GEPGINGGPS GDLYVEIHIK QHSVFERDGD DLHCQMPIPF TTAALGGEIE VPTLAGRASF       300
     TVPEGTQSGK TFRLRGKGIK GLRSSIAGDL YVHVQVETPV KLTEPQRDLL KQFEKALVEG       360
     GSRHSPQSKS WFDRVKSFFD                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page