(data stored in ACNUC7421 zone)

EMBL: CP000270.PE510

CP000270.PE510       Location/Qualifiers
FT   CDS             577235..578653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3951"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29048"
FT                   /db_xref="GOA:Q145E1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E1"
FT                   /protein_id="ABE29048.1"
FT                   /translation="MSTINTQHNPSFYSGKTATRSHYRLTTNRHGTYTLRLVVPKSLQS
FT                   LIQTKELKKSLRTRDFQKARMLAGHLSYQFDLMLATLMKKKLSDFNLDVINNIHKDLSV
FT                   TFNNVQYDFDINNEFERAEYLDLKARIEKHHADVGEVQKNVVVESSATQNSDKKYQSNF
FT                   KFVEVKDAFVKERMIKAGGKMTKSIDIYMASINEFWNKILSGTNPPITAINKLNARSFK
FT                   EHLIGTGITAQTVDNKVAHLQAFFTFIIKNYDYPFNNPFEGLKILNRAELKKVTNSFKP
FT                   FTMDELKIIFDVERYRAYYKKNIQLYFVPLIQLYSSMRVEEASQLHLDDIRQENGIYYF
FT                   NLNDDEDKSLKTINAFRNIPVHSKLIEIGLIKYYEERKKLGKRTLFDNQGEYVTTEFGA
FT                   YLKKLEIKKTARVHGTHSLRQNFNNALIDKDVISDVRCRLCGHELVGTNATVYGKDYKV
FT                   EELKRYIELVQFPI"
     MSTINTQHNP SFYSGKTATR SHYRLTTNRH GTYTLRLVVP KSLQSLIQTK ELKKSLRTRD        60
     FQKARMLAGH LSYQFDLMLA TLMKKKLSDF NLDVINNIHK DLSVTFNNVQ YDFDINNEFE       120
     RAEYLDLKAR IEKHHADVGE VQKNVVVESS ATQNSDKKYQ SNFKFVEVKD AFVKERMIKA       180
     GGKMTKSIDI YMASINEFWN KILSGTNPPI TAINKLNARS FKEHLIGTGI TAQTVDNKVA       240
     HLQAFFTFII KNYDYPFNNP FEGLKILNRA ELKKVTNSFK PFTMDELKII FDVERYRAYY       300
     KKNIQLYFVP LIQLYSSMRV EEASQLHLDD IRQENGIYYF NLNDDEDKSL KTINAFRNIP       360
     VHSKLIEIGL IKYYEERKKL GKRTLFDNQG EYVTTEFGAY LKKLEIKKTA RVHGTHSLRQ       420
     NFNNALIDKD VISDVRCRLC GHELVGTNAT VYGKDYKVEE LKRYIELVQF PI               472
//

If you have problems or comments...

PBIL Back to PBIL home page