(data stored in ACNUC7421 zone)

EMBL: CP000270.PE512

CP000270.PE512       Location/Qualifiers
FT   CDS             579499..579873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3949"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3949"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29050"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D9"
FT                   /protein_id="ABE29050.1"
FT                   /translation="MLSIVDEILTQYDALGLFINFQISKINLEMSKILQLMAEGKTPQQ
FT                   VTIKVGGTYPNHVFLVMYLVDGRLEAEEVSEALCDELASKISGINQEEFLAYKLTKVKT
FT                   KALKMRKDAEDKPPTGNEPK"
     MLSIVDEILT QYDALGLFIN FQISKINLEM SKILQLMAEG KTPQQVTIKV GGTYPNHVFL        60
     VMYLVDGRLE AEEVSEALCD ELASKISGIN QEEFLAYKLT KVKTKALKMR KDAEDKPPTG       120
     NEPK                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page