(data stored in ACNUC7421 zone)

EMBL: CP000270.PE520

CP000270.PE520       Location/Qualifiers
FT   CDS             587322..587639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3941"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29058"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D1"
FT                   /protein_id="ABE29058.1"
FT                   /translation="MSDDFHVENGRKGGEARAKKFWPKIKHSIILFIRFPELNQDEIAK
FT                   RVGASQAFVSKHTSYNALKIARLSAQSDSMSEDELEALLEKIKLEVELKNEIVKPKRSK
FT                   L"
     MSDDFHVENG RKGGEARAKK FWPKIKHSII LFIRFPELNQ DEIAKRVGAS QAFVSKHTSY        60
     NALKIARLSA QSDSMSEDEL EALLEKIKLE VELKNEIVKP KRSKL                       105
//

If you have problems or comments...

PBIL Back to PBIL home page