(data stored in ACNUC7421 zone)

EMBL: CP000270.PE521

CP000270.PE521       Location/Qualifiers
FT   CDS             complement(587841..588134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3940"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29059"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D0"
FT                   /protein_id="ABE29059.1"
FT                   /translation="MSLNCDIFDAYKSIIPKNMNPTTFTAELVRQFLAENFSKITHKPT
FT                   LVSREDFDDFIHGIVTHSELNELAKAHELRKQIDTTKEKLALLKKHETVGQA"
     MSLNCDIFDA YKSIIPKNMN PTTFTAELVR QFLAENFSKI THKPTLVSRE DFDDFIHGIV        60
     THSELNELAK AHELRKQIDT TKEKLALLKK HETVGQA                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page