(data stored in ACNUC7421 zone)

EMBL: CP000270.PE523

CP000270.PE523       Location/Qualifiers
FT   CDS             589351..590610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3938"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3938"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29061"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C8"
FT                   /protein_id="ABE29061.1"
FT                   /translation="MLANCFDSGTSGGDAPVRYLLGNKDHKGSERSVKPKLFRGDPEST
FT                   KDLIDSINNKQKYTSGVLAFRENEVPSVKQMHQICDEFERYMFGGLSKDRVNILWVLHN
FT                   DKGRPELHFVVPKIDLKSGKQLNISPPGKQNQDYYRLFGAYINDKFGWEQVSPKKKWDL
FT                   KAAEYKSETVPALYKRALCKQINNNYETGMFKDRNDLIKWLEQNKIQVLKQADDFITIG
FT                   VGGNKLRMYGEIFKQNPDMSVGKPYVFNQHEKNRLEHYRVERVAYFDKRFNTPPKPRFT
FT                   ASPQGKTTVKPQVFQTVADRIKEREVASMVQNMASIGGDVADVMPKEQKPSSGVSSGGG
FT                   SSGGADTSLQKVALSLRRNDILRQLIDATPSQVAELQNELTNIDIALGRLKLQEMEEAG
FT                   REMDKLYELYKKPQIDEAPT"
     MLANCFDSGT SGGDAPVRYL LGNKDHKGSE RSVKPKLFRG DPESTKDLID SINNKQKYTS        60
     GVLAFRENEV PSVKQMHQIC DEFERYMFGG LSKDRVNILW VLHNDKGRPE LHFVVPKIDL       120
     KSGKQLNISP PGKQNQDYYR LFGAYINDKF GWEQVSPKKK WDLKAAEYKS ETVPALYKRA       180
     LCKQINNNYE TGMFKDRNDL IKWLEQNKIQ VLKQADDFIT IGVGGNKLRM YGEIFKQNPD       240
     MSVGKPYVFN QHEKNRLEHY RVERVAYFDK RFNTPPKPRF TASPQGKTTV KPQVFQTVAD       300
     RIKEREVASM VQNMASIGGD VADVMPKEQK PSSGVSSGGG SSGGADTSLQ KVALSLRRND       360
     ILRQLIDATP SQVAELQNEL TNIDIALGRL KLQEMEEAGR EMDKLYELYK KPQIDEAPT        419
//

If you have problems or comments...

PBIL Back to PBIL home page