(data stored in ACNUC7421 zone)

EMBL: CP000270.PE528

CP000270.PE528       Location/Qualifiers
FT   CDS             596249..596920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3933"
FT                   /product="Putative DedA family transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3933"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29066"
FT                   /db_xref="GOA:Q145C3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C3"
FT                   /protein_id="ABE29066.1"
FT                   /translation="MDTLLHFVNLVLHIDKFLGDFIHVYGAWVYAVLFLIVFCETGLVV
FT                   LPFLPGDSLLFIGGAFCATGEMNIGLLIVLLLVAAISGNTVNYMIGRAIGPRVFNSHIP
FT                   FLERFLDRSALQKTHNFYEKHGGKTIVLARFIPVVRTFAPFVAGASEMTVSRFQLFNFV
FT                   GALFWVLLLTLLGYFFGNIPFIRQYLNVIVLVGIGAAVVPVVLGALWKMMRKNASSAGS
FT                   R"
     MDTLLHFVNL VLHIDKFLGD FIHVYGAWVY AVLFLIVFCE TGLVVLPFLP GDSLLFIGGA        60
     FCATGEMNIG LLIVLLLVAA ISGNTVNYMI GRAIGPRVFN SHIPFLERFL DRSALQKTHN       120
     FYEKHGGKTI VLARFIPVVR TFAPFVAGAS EMTVSRFQLF NFVGALFWVL LLTLLGYFFG       180
     NIPFIRQYLN VIVLVGIGAA VVPVVLGALW KMMRKNASSA GSR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page