(data stored in ACNUC7421 zone)

EMBL: CP000270.PE533

CP000270.PE533       Location/Qualifiers
FT   CDS             complement(601109..602272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3928"
FT                   /product="CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3928"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29071"
FT                   /db_xref="GOA:Q145B8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B8"
FT                   /protein_id="ABE29071.1"
FT                   /translation="MPRSAVARWLARLAPPPIALAWKERLRSCVGALVGIAFTGAITHL
FT                   LLGSSGNIPLLVAPMGASAVLLFAVPASPLAQPWSIIGGNLVSATVGVACASWIGDPLQ
FT                   AAPLAVAAAICAMFALRCVHPPSGAVALTAVLGGPAVHSLGYRFVLAPIALQSAALLCA
FT                   AIVYHALTGHRYPHSARQTTSRSDPAARSRPGFTRADLDAVLKGQSELLDIAPDDLESL
FT                   LRALQLQTYARSFDELTCASIMSRGVITVSAHTRAATAWSILQRHGVKALPVTNEERHV
FT                   VGIVTRADLGGVRQPGALTRLLRRLPGRRRANEPTVGTLMTTHVHTVDTTTPIADLVPL
FT                   FADFGHHHIPVLDSRTRQLAGMVTQANLIAGLYRQPNTSMQASQRTA"
     MPRSAVARWL ARLAPPPIAL AWKERLRSCV GALVGIAFTG AITHLLLGSS GNIPLLVAPM        60
     GASAVLLFAV PASPLAQPWS IIGGNLVSAT VGVACASWIG DPLQAAPLAV AAAICAMFAL       120
     RCVHPPSGAV ALTAVLGGPA VHSLGYRFVL APIALQSAAL LCAAIVYHAL TGHRYPHSAR       180
     QTTSRSDPAA RSRPGFTRAD LDAVLKGQSE LLDIAPDDLE SLLRALQLQT YARSFDELTC       240
     ASIMSRGVIT VSAHTRAATA WSILQRHGVK ALPVTNEERH VVGIVTRADL GGVRQPGALT       300
     RLLRRLPGRR RANEPTVGTL MTTHVHTVDT TTPIADLVPL FADFGHHHIP VLDSRTRQLA       360
     GMVTQANLIA GLYRQPNTSM QASQRTA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page