(data stored in ACNUC7421 zone)

EMBL: CP000270.PE535

CP000270.PE535       Location/Qualifiers
FT   CDS             complement(605011..606102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3924"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3924"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29073"
FT                   /db_xref="GOA:Q145B6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B6"
FT                   /protein_id="ABE29073.1"
FT                   /translation="MREAPIHTEESFRLLVEAIDDYAIFMLDASGNVVNWNTGARKMKG
FT                   YEVDEIIGRHFSVFYTPEDVAAGQPGLLLAAAVAQGRVVSEGWRVRKDGSKFWANVVIT
FT                   TVRTPTGELRGFAKVTQDLTERKRLEEFEQLRALAAHIQAAREEEQIRIARELHDDIGQ
FT                   QLTALKMALAGLDSIVRDQEAGAARTAPHIADMHQLIDATVASLRRIAAGLRPVMLETL
FT                   GLIPTLEWLIDDFMQRYDIAVEARIEADDMKLSEAADEGLFHIVQEALTNVARHAHADR
FT                   VTIDLARDGRTCVLRVTDDGQGMTPAAPSRPTSFGLLGMRERVHHLNGTMSIDSAPGRG
FT                   FRLTLIFPLDAVERKPSSPEGAA"
     MREAPIHTEE SFRLLVEAID DYAIFMLDAS GNVVNWNTGA RKMKGYEVDE IIGRHFSVFY        60
     TPEDVAAGQP GLLLAAAVAQ GRVVSEGWRV RKDGSKFWAN VVITTVRTPT GELRGFAKVT       120
     QDLTERKRLE EFEQLRALAA HIQAAREEEQ IRIARELHDD IGQQLTALKM ALAGLDSIVR       180
     DQEAGAARTA PHIADMHQLI DATVASLRRI AAGLRPVMLE TLGLIPTLEW LIDDFMQRYD       240
     IAVEARIEAD DMKLSEAADE GLFHIVQEAL TNVARHAHAD RVTIDLARDG RTCVLRVTDD       300
     GQGMTPAAPS RPTSFGLLGM RERVHHLNGT MSIDSAPGRG FRLTLIFPLD AVERKPSSPE       360
     GAA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page