(data stored in ACNUC7421 zone)

EMBL: CP000270.PE537

CP000270.PE537       Location/Qualifiers
FT   CDS             complement(606847..607596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3922"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3922"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29075"
FT                   /db_xref="GOA:Q145B4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B4"
FT                   /protein_id="ABE29075.1"
FT                   /translation="MTHRFSWLRFAAAACVAGTAFAAVPAHAGIFDDDQARQAILDLRS
FT                   KTDSLSGQLSAAQRTILDQSNRLDQLNQQVATLRGQNEDLGNQLATLQKQQKDYYTDLD
FT                   TRLKKFEPQQQTVDGVQGEVQPGETESFNAASQQFRNGDFKNAAASFRTFISRFPNSPY
FT                   QPTAQYWLGNALYALRDYKGSTAIWQGVVKNYPQHPRAPEALLAIANNQLEQGQKAAAR
FT                   KTLEQIVAQYSGSDVAQSAQSKLSQIK"
     MTHRFSWLRF AAAACVAGTA FAAVPAHAGI FDDDQARQAI LDLRSKTDSL SGQLSAAQRT        60
     ILDQSNRLDQ LNQQVATLRG QNEDLGNQLA TLQKQQKDYY TDLDTRLKKF EPQQQTVDGV       120
     QGEVQPGETE SFNAASQQFR NGDFKNAAAS FRTFISRFPN SPYQPTAQYW LGNALYALRD       180
     YKGSTAIWQG VVKNYPQHPR APEALLAIAN NQLEQGQKAA ARKTLEQIVA QYSGSDVAQS       240
     AQSKLSQIK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page