(data stored in ACNUC7421 zone)

EMBL: CP000270.PE538

CP000270.PE538       Location/Qualifiers
FT   CDS             complement(607616..608125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3921"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3921"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29076"
FT                   /db_xref="GOA:Q145B3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B3"
FT                   /protein_id="ABE29076.1"
FT                   /translation="MMSKLRFAFAVLMVGALAACHSGVKLDENANKGGSVSAQPNPNDV
FT                   ATVNVDPLNDPNSPLAKRSIYFDFDSYSVKDDYQSLLQQHAQYLKSHPQRHVLIQGNTD
FT                   ERGTSEYNLALGQKRAEAVRRSLSLMGVTDSQMEAVSLGKEKPQATGHDESSWAQNRRA
FT                   DLVYQQ"
     MMSKLRFAFA VLMVGALAAC HSGVKLDENA NKGGSVSAQP NPNDVATVNV DPLNDPNSPL        60
     AKRSIYFDFD SYSVKDDYQS LLQQHAQYLK SHPQRHVLIQ GNTDERGTSE YNLALGQKRA       120
     EAVRRSLSLM GVTDSQMEAV SLGKEKPQAT GHDESSWAQN RRADLVYQQ                   169
//

If you have problems or comments...

PBIL Back to PBIL home page