(data stored in ACNUC7421 zone)

EMBL: CP000270.PE539

CP000270.PE539       Location/Qualifiers
FT   CDS             complement(608158..609450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3920"
FT                   /product="Putative periplasmic TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3920"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29077"
FT                   /db_xref="GOA:Q145B2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145B2"
FT                   /protein_id="ABE29077.1"
FT                   /translation="MSLMTKLGLRTLVASCLIAVGGAANAQLNVLVTGVGSTQFPIATA
FT                   NFANEANSPQQVSTIVRQDLQRSGKFTNIDAGATPVSETDSVDLGSWKAKGANAFVSGS
FT                   VNRLPNGQYEVRFKLYDTVKGESLGGLVLVSPESGLRMSAHKVADYIYAKLMGGRGVFA
FT                   TRLSYVIKTGGRYQLQISDSDGQDAHIALSSPEPIISPAWSPDGTKVAYVSFEKKKPIV
FT                   YIHDLPTGRRIVVSDQKGNNSAPAWSPDGRTLAVALSRTGNTQIFAVNADGSGLRRLTQ
FT                   GSSIDTEPCFSPDGQSIYFTSDRGGQPQIYKMSAQGENAGAAQRVTFTGSYNTSPRVSP
FT                   DGKQLAYISRVGGGFKLYIQDLQGNTATGLTDTTHDESPSFAANGQYILYATQVNGRGV
FT                   LAAVSTDGRTRQVLSVQGGSVREPSWGPFMQ"
     MSLMTKLGLR TLVASCLIAV GGAANAQLNV LVTGVGSTQF PIATANFANE ANSPQQVSTI        60
     VRQDLQRSGK FTNIDAGATP VSETDSVDLG SWKAKGANAF VSGSVNRLPN GQYEVRFKLY       120
     DTVKGESLGG LVLVSPESGL RMSAHKVADY IYAKLMGGRG VFATRLSYVI KTGGRYQLQI       180
     SDSDGQDAHI ALSSPEPIIS PAWSPDGTKV AYVSFEKKKP IVYIHDLPTG RRIVVSDQKG       240
     NNSAPAWSPD GRTLAVALSR TGNTQIFAVN ADGSGLRRLT QGSSIDTEPC FSPDGQSIYF       300
     TSDRGGQPQI YKMSAQGENA GAAQRVTFTG SYNTSPRVSP DGKQLAYISR VGGGFKLYIQ       360
     DLQGNTATGL TDTTHDESPS FAANGQYILY ATQVNGRGVL AAVSTDGRTR QVLSVQGGSV       420
     REPSWGPFMQ                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page