(data stored in ACNUC7421 zone)

EMBL: CP000270.PE546

CP000270.PE546       Location/Qualifiers
FT   CDS             614974..615456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3913"
FT                   /product="Protein of unknown function DUF193"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3913"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29084"
FT                   /db_xref="GOA:Q145A5"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145A5"
FT                   /protein_id="ABE29084.1"
FT                   /translation="MHCPFCRHADTQVVDSRVSEDGATIRRRRRCPACDKRFTTYERVE
FT                   LALPSVVKKDGSRTEFDRRKIVASMQLALRKRPVAADAIEAAVARIEYQLLGSGEREVR
FT                   SERLGELVMNELRALDTIAYVRFASVYRRFEDVSEFEDVIEEFRRASSPPKPSRKR"
     MHCPFCRHAD TQVVDSRVSE DGATIRRRRR CPACDKRFTT YERVELALPS VVKKDGSRTE        60
     FDRRKIVASM QLALRKRPVA ADAIEAAVAR IEYQLLGSGE REVRSERLGE LVMNELRALD       120
     TIAYVRFASV YRRFEDVSEF EDVIEEFRRA SSPPKPSRKR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page