(data stored in ACNUC7421 zone)

EMBL: CP000270.PE547

CP000270.PE547       Location/Qualifiers
FT   CDS             615670..616230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3912"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3912"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29085"
FT                   /db_xref="GOA:Q145A4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A4"
FT                   /protein_id="ABE29085.1"
FT                   /translation="MKWNAVGWPRCRGFTLVETLAVVALLAVIAVMSTPSFVAWYVRDQ
FT                   VDARAKALVATLAYARSEALRQGARVTVCRTDGARHCLAAGQPCGNGIADWSCGWAVLA
FT                   ERGGALSLLRAQPLLAAVSIAGTQTNLTFTPPAGQLIGTFRSFDIAPRAPSRATQGARW
FT                   RRCIRIAAGGRARITEGACGAAS"
     MKWNAVGWPR CRGFTLVETL AVVALLAVIA VMSTPSFVAW YVRDQVDARA KALVATLAYA        60
     RSEALRQGAR VTVCRTDGAR HCLAAGQPCG NGIADWSCGW AVLAERGGAL SLLRAQPLLA       120
     AVSIAGTQTN LTFTPPAGQL IGTFRSFDIA PRAPSRATQG ARWRRCIRIA AGGRARITEG       180
     ACGAAS                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page