(data stored in ACNUC7421 zone)

EMBL: CP000270.PE549

CP000270.PE549       Location/Qualifiers
FT   CDS             617644..618090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3910"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3910"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29087"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A2"
FT                   /protein_id="ABE29087.1"
FT                   /translation="MMLATSAAWFETSLAAARGAINVREYLQAFHAADSALTLCVRNAI
FT                   AAAAVQTSAPPPIASGEPTQWKLEAAFEAGAILPVAQWPGSLRPPQCLIEAWRLASRAD
FT                   ARAYLLTSRGFGRTRESQVWLQIELVIDGDKIERHWRHVASRPF"
     MMLATSAAWF ETSLAAARGA INVREYLQAF HAADSALTLC VRNAIAAAAV QTSAPPPIAS        60
     GEPTQWKLEA AFEAGAILPV AQWPGSLRPP QCLIEAWRLA SRADARAYLL TSRGFGRTRE       120
     SQVWLQIELV IDGDKIERHW RHVASRPF                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page