(data stored in ACNUC7421 zone)

EMBL: CP000270.PE56

CP000270.PE56        Location/Qualifiers
FT   CDS             72371..73003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4406"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28594"
FT                   /db_xref="GOA:Q146Z5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z5"
FT                   /protein_id="ABE28594.1"
FT                   /translation="MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAV
FT                   CRFCDTDFVGTDGENGGKYRTAEDLVRMIASQWPQGEGERFVVCTGGEPMLQIDQPLVD
FT                   ALHAAGFEIAIETNGSLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSEYA
FT                   KLDFEYFLVQPMDGPSREINTRLAIDWCKRHPQWRLSMQTHKYLNIP"
     MTYAVKEIFY TLQGEGANAG RPAVFCRFAG CNLWSGREED RAEAVCRFCD TDFVGTDGEN        60
     GGKYRTAEDL VRMIASQWPQ GEGERFVVCT GGEPMLQIDQ PLVDALHAAG FEIAIETNGS       120
     LPVLETIDWI CVSPKADAPL VVTKGNELKV VIPQDNQRLS EYAKLDFEYF LVQPMDGPSR       180
     EINTRLAIDW CKRHPQWRLS MQTHKYLNIP                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page